Longitudinal high-throughput TCR repertoire profiling reveals the dynamics of T cell memory formation after mild COVID-19 infection
Abstract
COVID-19 is a global pandemic caused by the SARS-CoV-2 coronavirus. T cells play a key role in the adaptive antiviral immune response by killing infected cells and facilitating the selection of virus-specific antibodies. However neither the dynamics and cross-reactivity of the SARS-CoV-2-specific T cell response nor the diversity of resulting immune memory are well understood. In this study we use longitudinal high-throughput T cell receptor (TCR) sequencing to track changes in the T cell repertoire following two mild cases of COVID-19. In both donors we identified CD4+ and CD8+ T cell clones with transient clonal expansion after infection. The antigen specificity of CD8+ TCR sequences to SARS-CoV-2 epitopes was confirmed by both MHC tetramer binding and presence in large database of SARS-CoV-2 epitope-specific TCRs. We describe characteristic motifs in TCR sequences of COVID-19-reactive clones and show preferential occurence of these motifs in publicly available large dataset of repertoires from COVID-19 patients. We show that in both donors the majority of infection-reactive clonotypes acquire memory phenotypes. Certain T cell clones were detected in the memory fraction at the pre-infection timepoint, suggesting participation of pre-existing cross-reactive memory T cells in the immune response to SARS-CoV-2.
Introduction
COVID-19 is a global pandemic caused by the novel SARS-CoV-2 betacoronavirus vabret_immunology_2020 . T cells are crucial for clearing respiratory viral infections and providing long-term immune memory schmidt_cd8_2018 ; swain_expanding_2012 . Two major subsets of T cells participate in the immune response to viral infection in different ways: activated CD8+ T cells directly kill infected cells, while subpopulations of CD4+ T cells produce signaling molecules that regulate myeloid cell behaviour, drive and support CD8 response and the formation of long-term CD8 memory, and participate in the selection and affinity maturation of antigen specific B-cells, ultimately leading to the generation of neutralizing antibodies. In SARS-1 survivors, antigen-specific memory T cells were detected up to 11 years after the initial infection, when viral-specific antibodies were undetectable ng_memory_2016 ; oh_engineering_2011 . The T cell response was shown to be critical for protection in SARS-1-infected mice zhao_t_2010 . Patients with X-linked agammaglobulinemia, a genetic disorder associated with lack of B cells, have been reported to recover from symptomatic COVID-19 quinti_possible_2020 ; soresina_two_2020 , suggesting that in some cases T cells are sufficient for viral clearance. Theravajan et al. showed that activated CD8+HLA-DR+CD38+ T cells in a mild case of COVID-19 significantly expand following symptom onset, reaching their peak frequency of 12% of CD8+ T cells on day 9 after symptom onset, and contract thereafter thevarajan_breadth_2020 . Given the average time of 5 days from infection to the onset of symptoms bi_epidemiology_2020 , the dynamics and magnitude of T cell response to SARS-CoV-2 is similar to that observed after immunization with live vaccines miller_human_2008 . SARS-CoV-2-specific T cells were detected in COVID-19 survivors by activation following stimulation with SARS-CoV-2 proteins ni_detection_2020 , or by viral protein-derived peptide pools weiskopf_phenotype_2020 ; braun_presence_2020 ; snyder_magnitude_2020 ; le_bert_sars-cov-2-specific_2020 ; meckiff_single-cell_2020 ; bacher_pre-existing_2020 ; peng_broad_2020 . Some of the T cells activated by peptide stimulation were shown to have a memory phenotype weiskopf_phenotype_2020 ; le_bert_sars-cov-2-specific_2020 ; mateus_selective_2020 , and some potentially cross-reactive CD4+ T cells were found in healthy donors braun_presence_2020 ; grifoni_targets_nodate ; sekine_robust_2020 ; bacher_pre-existing_2020 .
T cells recognise short pathogen-derived peptides presented on the cell surface of the Major Histocompatibility Complex (MHC) using hypervariable T cell receptors (TCR). TCR repertoire sequencing allows for the quantitative tracking of T cell clones in time, as they go through the expansion and contraction phases of the response. It was previously shown that quantitative longitudinal TCR sequencing is able to identify antigen-specific expanding and contracting T cells in response to yellow fever vaccination with high sensitivity and specificity minervina_primary_2020 ; pogorelyy_precise_2018 ; dewitt_dynamics_2015 . Not only clonal expansion but also significant contraction from the peak of the response are distinctive traits of T cell clones specific to the virus pogorelyy_precise_2018 .
In this study we use longitudinal TCRalpha and TCRbeta repertoire sequencing to quantitatively track T cell clones that significantly expand and contract after recovery from a mild COVID-19 infection, and determine their phenotype. We reveal the dynamics and the phenotype of the memory cells formed after infection, identify pre-existing T cell memory clones participating in the response, and describe public TCR sequence motifs of SARS-CoV-2-reactive clones, suggesting a response to immunodominant epitopes.
Results
Longitudinal tracking of TCR repertoires of COVID-19 patients

In the middle of March (day 0) donor W female and donor M (male, both healthy young adults), returned to their home country from the one of the centers of the COVID-19 outbreak in Europe at the time. Upon arrival, according to local regulations, they were put into strict self-quarantine for 14 days. On day 3 of self-isolation both developed low grade fever, fatigue and myalgia, which lasted 4 days and was followed by a temporary loss of smell for donor M. On days 15, 30, 37, 45 and 85 we collected peripheral blood samples from both donors (Fig. 1a). The presence of IgG and IgM SARS-CoV-2 specific antibodies in the plasma was measured at all timepoints using SARS-CoV-2 S-RBD domain specific ELISA (Fig. S1). From each blood sample we isolated PBMCs (peripheral blood mononuclear cells, in two biological replicates), CD4+, and CD8+ T cells. Additionally, on days 30, 45 and 85 we isolated four T cell memory subpopulations (Fig. S2): Effector Memory (EM: CCR7-CD45RA-), Effector Memory with CD45RA re-expression (EMRA: CCR7-CD45RA+), Central Memory (CM: CCR7+CD45RA-), and Stem Cell-like Memory (SCM: CCR7+CD45RA+CD95+). From all samples we isolated RNA and performed TCRalpha and TCRbeta repertoire sequencing as previously described pogorelyy_persisting_2017 . For both donors, TCRalpha and TCRbeta repertoires were obtained for other projects one and two years prior to infection. Additionally, TCR repertoires of multiple samples for donor M – including sorted memory subpopulations – are available from a published longitudinal TCR sequencing study after yellow fever vaccination (donor M1 samples in minervina_primary_2020 ).
Two waves of T-cell clone response
From previously described activated T cell dynamics for SARS-CoV-2 thevarajan_breadth_2020 , and immunization with live vaccines miller_human_2008 , the peak of the T cell expansion is expected around day 15 post-infection, and responding T cells significantly contract afterwards. However, Weiskopf et al. weiskopf_phenotype_2020 reports an increase of SARS-CoV-2-reactive T cells at later timepoints, peaking in some donors after 30 days following symptom onset. To identify groups of T cell clones with similar dynamics in an unbiased way, we used Principal Component Analysis (PCA) in the space of T cell clonal trajectories (Fig. 1b and c). This exploratory data analysis method allows us to visualize major trends in the dynamics of abundant TCR clonotypes (occuring within top 1000 on any post-infection timepoints) between multiple timepoints.
In both donors, and in both TCRalpha and TCRbeta repertoires, we identified three clusters of clones with distinct dynamics. The first cluster (Fig. 1bc, purple) corresponded to abundant TCR clonotypes which had constant concentrations across timepoints, the second cluster (Fig. 1bc, green) showed contraction dynamics from day 15 to day 85, and the third cluster (Fig. 1bc, yellow), showed an unexpected clonal expansion from day 15 with a peak on day 37 followed by contraction. The clustering and dynamics are similar in both donors and are reproduced in TCRbeta (Fig. 1bc) and TCRalpha (Fig. S3ab) repertoires. We next used edgeR, a software for differential gene expression analysis robinson_edger:_2010 and NoisET, a Bayesian differential expansion model puelma_touzel_inferring_2020 , to specifically detect changes in clonotype concentration between pairs of timepoints in a statistically reliable way and without limiting the analysis to the most abundant clonotypes. Both NoisET and edgeR use biological replicate samples collected at each timepoint to train a noise model for sequence counts. Results for the two models were similar (Fig. S4) and we conservatively defined as expanded or contracted the clonotypes that were called by both models simultaneously. We identified 291 TCRalpha and 295 TCRbeta clonotypes in donor W, and 607 TCRalpha and 616 TCRbeta in donor M significantly contracted from day 15 to day 85 (largely overlapping with cluster 2 of clonal trajectories, Fig. S5). 176 TCRalpha and 278 TCRbeta for donor W, and 293 TCRalpha and 427 TCRbeta clonotypes for donor M were significantly expanded from day 15 to 37 (corresponding to cluster 3 of clonal trajectories).
Note that, to identify putatively SARS-CoV-2 reactive clones, we only used post-infection timepoints, so that our analysis can be reproduced in other patients and studies where pre-infection timepoints are unavailable. However, tracking the identified responding clones back to pre-infection timepoints reveals strong clonal expansions from pre- to post-infection (Fig. 1de, Fig. S3cd). For brevity, we further refer to clonotypes significantly contracted from day 15 to 85 as contracting clones and clonotypes significantly expanding from day 15 to 37 as expanding clones. Contracting clones corresponded to 2.5% and 0.9% of T cells on day 15 post-infection, expanding clones reached 1.1% and 0.8% on day 37 for donors M and W respectively (Fig. 1de, left). This magnitude of the T cell response is of the same order of magnitude as previously observed after live yellow fever vaccine immunization of donor M (6.7% T cells on day 15 post-vaccination). For each contracting and expanding clone we determined their CD4/CD8 phenotype using separately sequenced repertoires of CD4+ and CD8+ subpopulations (see Methods). Both CD4+ and CD8+ subsets participated actively in the response (Fig. 1de). Interestingly, clonotypes expanding after day 15 were significantly biased towards the CD4+ phenotype, while contracting clones had balanced CD4/CD8 phenotype fractions in both donors (Fisher exact test, for both donors).

Memory formation and pre-existing memory
On days 30, 45 and 85 we identified both contracting (Fig. 2a-c) and expanding (Fig. S6a-c) T cell clones in the memory subpopulations of peripheral blood. Both CD4+ and CD8+ responding clones were found in the CM and EM subsets, however CD4+ were more biased towards CM (with exception of donor W day 30 timepoint, where a considerable fraction of CD8+ clones were found in CM), and CD8+ clones more represented in the EMRA subset. A small number of both CD4+ and CD8+ responding clonotypes were also identified in the SCM subpopulation, which was previously shown to be a long-lived T cell memory subset fuertes_marraco_long-lasting_2015 . Note that we sequenced more cells from PBMC than from the memory subpopulations (Table S1), so that some low-abundant responding T cell clones are not sampled in the memory subpopulations. Intriguingly, a number of responding CD4+ clones, and fewer CD8+ clones, were also represented in the repertoires of both donors 1 and 2 years before the infection. Pre-existing clones were expanded after infection, and contracted afterwards for both donors (Fig. S7). For donor M, for whom we had previously sequenced memory subpopulations before the infection minervina_primary_2020 , we were able to identify pre-existing SARS-CoV-2-reactive CD4+ clones in the CM subpopulation 1 year before the infection and a group of CD8+ clones in the pre-infection EM subpopulation. Interestingly, on day 30 after infection the majority of pre-infection CM clones were detected in the EM subpopulation, suggesting recent T cell activation and a switch of the phenotype from memory to effector. These clones might represent memory T cells cross-reactive for other infections, e.g. other human coronaviruses.
A search for TCRbeta amino acid sequences of responding clones in VDJdb bagaev_vdjdb_2020 — a database of TCRs with known specificities — resulted in essentially no overlap with TCRs not specific for SARS-CoV-2 epitopes: only two clonotypes matched. One match corresponded to the CMV (cytomegalovirus) epitope presented by the HLA-A*03 MHC allele, which is absent in both donors (Table S2), and a second match was for Influenza A virus epitope presented by HLA-A*02 allele. The absence of matches suggests that contracting and expanding clones are unlikely to be specific for immunodominant epitopes of common pathogens covered in VDJdb. We next asked if we could map specificites of our responding clones to SARS-CoV-2 epitopes.
Validation by MHC tetramer-staining assay
On day 25 post-infection donor M participated in study by Shomuradova et al. Shomuradova2020 (as donor p1434), where his CD8+ T cells were stained with HLA-A*02:01-YLQPRTFLL MHC-I tetramer. TCRalpha and TCRbeta of FACS-sorted tetramer-positive cells were sequenced and deposited to VDJdb (see Shomuradova2020 for the experimental details). We matched these tetramer-specific TCR sequences to our longitudinal dataset (Fig. 3a for TCRbeta and Fig. S8 for TCRalpha). We found that their frequencies were very low on pre-infection timepoints and monotonically decreased from their peak on day 15 ( fraction of bulk TCRbeta repertoire) to day 85 ( fraction), in close analogy to our contracting clone set. Among the tetramer positive clones that were abundant on day 15 (with bulk frequency ), 17 out of 18 or TCRbetas and 12 out of 15 TCRalphas were independently identified as contracting by our method.

TCR sequence motifs of responding clones
It was previously shown that TCRs recognising the same antigens frequently have highly similar TCR sequences dash_quantifiable_2017 ; glanville_identifying_2017 . To identify motifs in TCR amino acid sequences, we plotted similarity networks for significantly contracted (Fig. 3bc, Fig. 4ab) and expanded (Fig. S9b-e) clonotypes. The number of edges in all similarity networks except CD8+ expanding clones was significantly larger than would expected by randomly sampling the same number of clonotypes from the corresponding repertoire (Fig. 3d and Fig. S9a). In both donors we found clusters of highly similar clones in both CD4+ and CD8+ subsets for expanding and contracting clonotypes. Clusters were largely donor-specific, as expected, since our donors have dissimilar HLA alleles (SI Table 1) and thus each is likely to present a non-overlapping set of T cell antigens. The largest cluster, described by the motif TRAV35-CAGXNYGGSQGNLIF-TRAJ42, was identified in donor M’s CD4+ contracting alpha chains. Clones from this cluster constituted 16.3% of all of donor M’s CD4+ responding cells on day 15, suggesting a response to an immunodominant CD4+ epitope in the SARS-CoV-2 proteome. The high similarity of the TCR sequences of responding clones in this cluster allowed us to independently identify motifs from donor M’s CD4 alpha contracting clones using the ALICE algorithm pogorelyy_detecting_2019 (Fig. S10). While the time dependent methods (Fig. 1) identify abundant clones, the ALICE approach is complementary to both edgeR and NoisET as it identifies clusters of T cells with similar sequences independently of their individual abundances.

Mapping TCR motifs to SARS-CoV-2 epitopes
In CD8+ T cells, 3 clusters of highly similar TCRbeta clonotypes in donor M and one cluster of TCRalpha clonotypes correspond to YLQPRTFLL-tetramer-specific TCR sequences described above. To map additional specificities for CD8+ TCRbetas, we used a large set of SARS-CoV-2-peptide specific TCRbeta sequences from snyder_magnitude_2020 obtained using Multiplex Identification of Antigen-specific T cell Receptors Assay (MIRA) with combinatorial peptide pools klinger_multiplex_2015 . For each responding CD8+ TCRbeta we searched for the identical or highly similar (same VJ combination, up to one mismatch in CDR3aa) TCRbeta sequences specific for given SARS-CoV-2 peptides. A TCRbeta sequence from our set was considered mapped to a given peptide if it had at least two highly similar TCRbeta sequences specific for this peptide in the MIRA experiment. This procedure yielded unambiguous matches for 32 CD8+ TCRbetas — just one clonotype was paired to two peptide pools (Table S3). The vast majority of matches to MIRA corresponded to groups of contracting clones. As expected, we found that all clusters corresponding to HLA-A*02:01-YLQPRTFLL MHC-I tetramer-specific TCRs were matched to the peptide pool YLQPRTFL,YLQPRTFLL,YYVGYLQPRTF in the MIRA dataset. Another large group of matches corresponded to the HLA-B*15:01-restricted stamatakis_generation_2020 NQKLIANQF epitope. Interestingly, clonotypes corresponging to this cluster together made up 21% of the CD8+ immune response on day 15, suggesting immunodominance of this epitope. Two TCRbeta clonotypes mapped to this epitope were identified in Effector Memory subset one year before the infection, suggesting potential cross-reactive response. We speculate, that this response might be initially triggered by NQKLIANAF, a homologous HLA-B*15:01 epitope from HKU1 or OC43, common human betacoronaviruses. To predict potential pairings between TCRalpha and TCRbeta motifs, we used a method of alpha/beta clonal trajectory matching described in minervina_primary_2020 (see Methods for details). We found consistent pairing between one of the motifs in TCRalpha to the largest motif in TCRbeta T cells, which is associated to HLA-B*15:01-NQKLIANQF.
Validation of CD4+ COVID-19 HLA-restricted specificity by cohort association analysis
At the time of writing, no data on TCR sequences specific to MHC-II class epitopes exist to map specificities of CD4+ T-cells in a similar way as we did with MIRA-specific TCRs. However, a recently published database of 1414 bulk TCRbeta repertoires from COVID-19 patients allowed us to confirm the SARS-CoV-2 specificity of contracting clones indirectly. Public TCRbeta sequences that can recognize SARS-CoV-2 epitopes are expected to be clonally expanded and thus sampled more frequently in the repertoires of COVID-19 patients than in control donors. In Fig. 4cd we show that the total frequency of TCRbeta sequences forming the largest cluster in donor M (Fig. 4c) and donor W (Fig. 4d) is significantly larger in the COVID-19 cohort than in the healthy donor cohort from ref. emerson_immunosequencing_2017 , suggesting antigen-dependent clonal expansion. We hypothesized that the difference between control and COVID-19 donors in motif abundance should be even larger if we restrict the analysis to donors sharing the HLA allele that presents the epitope. Unfortunately, HLA-typing information is not yet available for the COVID-19 cohort. However, using sets of HLA-associated TCRbeta sequences from ref. Dewitt2018 , we could build a simple classifier to predict the HLA alleles of donors from both the control and COVID-19 cohorts exploiting the presence of TCRbeta sequences associated with certain HLA alleles (see Methods for details). We found that the CD4+ TCRbeta motif from donor W occurs preferentially in donors predicted to have DRB1*07:01 allele, while the motif from donor M appears to be associated with HLA-DRB1*03:01-DQB1*02:01 haplotype. The frequency of sequences corresponding to these motifs can then be used to identify SARS-CoV-2 infected donors with matching HLA alleles (Fig. S11).
Discussion
Using longitudinal repertoire sequencing, we identified a group of CD4+ and CD8+ T cell clones that contract after recovery from a SARS-CoV-2 infection. Our response timelines agree with T cell dynamics reported by Theravajan et al. thevarajan_breadth_2020 for mild COVID-19, as well as with dynamics of T cell response to live vaccines miller_human_2008 . We further mapped the specificities of contracting CD8+ T cells using sequences of SARS-CoV-2 specific T cells identified with tetramer staining in the same donor, and as well as the large set of SARS-CoV-2 peptide stimulated TCRbeta sequences from ref. snyder_magnitude_2020 . For large CD4+ TCRbeta motifs we show strong association with COVID-19 by analysing the occurence patterns and frequencies of these sequences in a large cohort of COVID-19 patients. Surprisingly, in both donors we also identified a group of predominantly CD4+ clonotypes which expanded from day 15 to day 37 after the infection. One possible explanation for this second wave of expansion is the priming of CD4+ T cells by antigen-specific B-cells, but there might be other mechanisms such as the migration of SARS-CoV-2 specific T cells from lymphoid organs or bystander activation of non-SARS-CoV-2 specific T cells. It is also possible that later expanding T cells are triggered by another infection, simultaneously and asymptomatically occurring in both donors around day 30. In contrast with the first wave of response identified by contracting clones, for now we do not have confirmation that this second wave of expansion corresponds to SARS-CoV-2 specific T cells. Accumulation of TCR sequences for CD4+ SARS-CoV-2 epitope specific T cells may further address this question. We showed that a large fraction of putatively SARS-CoV-2 reactive T cell clones are later found in memory subpopulations and remain there at least 3 months after infection. Importantly, some of responding clones are found in long-lived stem cell-like (SCM) memory subset, as also reported for SARS-CoV-2 convalescent patients in ref. sekine_robust_2020 . A subset of CD4+ clones were identified in pre-infection central memory subsets, and a subset of CD8+ T cells were found in effector memory. Among these are CD8+ clones recognising NQKLIANQF, an immunodominant HLA-B*15:01 restricted SARS-CoV-2 epitope, for which homologous epitope differing by 1 aa mismatch exists in common human betacoronaviruses. The presence of SARS-CoV-2 cross-reactive CD4+ T cells in healthy individuals was recently demonstrated braun_presence_2020 ; grifoni_targets_nodate ; le_bert_sars-cov-2-specific_2020 ; meckiff_single-cell_2020 ; bacher_pre-existing_2020 ; peng_broad_2020 . Our data further suggests that cross-reactive CD4+ and CD8+ T cells can participate in the response in vivo. It is interesting to ask if the presence of cross-reactive T cells before infection is linked to the mildness of the disease (with predicted HLA-B*15:01 cross-reactive epitope described above as a good starting point). Larger studies with cohorts of severe and mild cases with pre-infection timepoints are needed to address this question.
Methods
Donors and blood samples
Peripheral blood samples from two young healthy adult volunteers, donor W (female) and donor M (male) were collected with written informed consent in a certified diagnostics laboratory. Both donors gave written informed consent to participate in the study under the declaration of Helsinki. HLA alleles of both donors (Table S2) were determined by an in-house cDNA high-throughput sequencing method.
SARS-CoV-2 S-RBD domain specific ELISA
An ELISA assay kit developed by the National Research Centre for Hematology was used for detection of anti-S-RBD IgG according to the manufacturer’s protocol. The relative IgG level (OD/CO) was calculated by dividing the OD (optical density) values by the mean OD value of the cut-off positive control serum supplied with the Kit (CO). OD values of d37, d45 and d85 samples for donor M exceeded the limit of linearity for the Kit. In order to properly compare the relative IgG levels between d30, d37, d45 and d85, these samples were diluted 1:400 instead of 1:100, the ratios d37:d30 and d45:d30 and d85:d30 were calculated and used to calculate the relative IgG level of d37, d45 and d85 by multiplying d30 OD/CO value by the corresponding ratio. Relative anti-S-RBD IgM level was calculated using the same protocol with anti-human IgM-HRP conjugated secondary antibody. Since the control cut-off serum for IgM was not available from the Kit, on Fig. S1b. we show OD values for nine biobanked pre-pandemic serum samples from healthy donors.
Isolation of PBMCs and T cell subpopulations
PBMCs were isolated with the Ficoll-Paque density gradient centrifugation protocol. CD4+ and CD8+ T cells were isolated from PBMCs with Dynabeads CD4+ and CD8+ positive selection kits (Invitrogen) respectively. For isolation of EM, EMRA, CM and SCM memory subpopulations we stained PBMCs with the following antibody mix: anti-CD3-FITC (UCHT1, eBioscience), anti-CD45RA-eFluor450 (HI100, eBioscience), anti-CCR7-APC (3D12, eBioscience), anti-CD95-PE (DX2, eBioscience). Cell sorting was performed on FACS Aria III, all four isolated subpopulations were lysed with Trizol reagent immediately after sorting.
TCR library preparation and sequencing
TCRalpha and TCRbeta cDNA libraries preparation was performed as previously described in pogorelyy_persisting_2017 . RNA was isolated from each sample using Trizol reagent according to the manufacturer’s instructions. A universal primer binding site, sample barcode and unique molecular identifier (UMI) sequences were introduced using the 5’RACE technology with TCRalpha and TCRbeta constant segment specific primers for cDNA synthesis. cDNA libraries were amplified in two PCR steps, with introduction of the second sample barcode and Illumina TruSeq adapter sequences at the second PCR step. Libraries were sequenced using the Illumina NovaSeq platform (2x150bp read length).
TCR repertoire data analysis
Raw data preprocessing. Raw sequencing data was demultiplexed and UMI guided consensuses were built using migec v.1.2.7 shugay_towards_2014 . Resulting UMI consensuses were aligned to V and J genomic templates of the TRA and TRB locus and assembled into clonotypes with mixcr v.2.1.11 bolotin_mixcr:_2015 . See Table S1 for the number of cells, UMIs and unique clonotypes for each sample.
Identification of clonotypes with active dynamics. Principal component analysis (PCA) of clonal trajectories was performed as described before minervina_primary_2020 . First we selected clones which were present among the top 1000 abundant in any of post-infection PBMC repertoires, including biological replicates, i.e. considered clone abundant if it was found within top 1000 most abundant clonotypes in at least one of the replicate samples at one timepoint. Next, for each such abundant clone we calculated its frequency at each post-infection timepoint and divided this frequency by the maximum frequency of this clone for normalization. Then we performed PCA on the resulting normalized clonal trajectory matrix and identified three clusters of trajectories with hierarchical clustering with average linkage, using Euclidean distances between trajectories. We identify statistically significant contractions and expansions with edgeR as previously described pogorelyy_precise_2018 , using FDR adjusted and fold change threshold of 1. NoisET implements the Bayesian detection method described in puelma_touzel_inferring_2020 . Briefly, a two-step noise model accounting for cell sampling and expression noise is inferred from replicates, and a second model of expansion is learned from the two timepoints to be compared. The procedure outputs the posterior probability of expansion or contraction, and the median estimated fold change, whose thresholds are set to 0.05 and 1 respectively.
Mapping of COVID-19 associated TCRs to the MIRA database. TCRbeta sequences from T cells specific for SARS-CoV-2 peptide pools MIRA (ImmuneCODE release 2) were downloaded from https://clients.adaptivebiotech.com/pub/covid-2020. V and J genomic templates were aligned to TCR nucleotide sequences from the MIRA database using mixcr 2.1.11. We consider a TCRbeta from MIRA matched to a TCRbeta from our data, if it had the same V and J and at most one mismatch in CDR3 amino acid sequence. We consider a TCRbeta sequence mapped to an epitope if it has at least two identical or highly similar (same V, J and up to one mismatch in CDR3 amino acid sequence) TCRbeta clonotypes reactive for this epitope in the MIRA database.
Computational alpha/beta pairing by clonal trajectories. Computational alpha/beta pairing was performed as described in minervina_primary_2020 . For each TCRbeta we determine the TCRalpha with the closest clonal trajectory (Tables S3 and S5). We observe no stringent pairings between TCRbeta and TCRbeta motifs with exception of two contracting CD8 TCRbeta clusters: TRBV7-2/TRBJ1-2 NQKLIANQF-associated clones from donor M paired to TRAV21/TRAJ40 alphas from the same cluster (CASSLEDTNYGYTF-CAVHSSGTYKYIF and CASSLEDTIYGYTF-CAALTSGTYKYIF), and TRBV7-9/TRBJ2-3 beta cluster paired to largest alpha cluster (CASSPTGRGRTDTQYF-CAYRSGGSEKLVF and CASSPTGRGGTDTQYF-CAYRRPGGEKLTF).
Computational prediction of HLA-types. To predict HLA-types from TCR repertoires of COVID-19 cohort we used sets of HLA-associated TCR sequences from Dewitt2018 . We use TCRbeta repertoires of 666 donors from cohort from emerson_immunosequencing_2017 , for which HLA-typing information is available in ref. Dewitt2018 as a training set to fit logistic regression model, where presence or absense of given HLA-allele is an outcome, and the number of allele-associated sequences in repertoire, as well as the total number of unique sequences in the repertoire, are the predictors. A separate logistic regression model was fitted for each set of HLA-associated sequences from ref. Dewitt2018 , and then used to predict the probability that a donor from the COVID-19 cohort has this allele. Donors with were considered negative for a given allele.
Data availability
Raw sequencing data are deposited to the Short Read Archive (SRA) accession: PRJNA633317. Processed TCRalpha and TCRbeta repertoire datasets, resulting repertoires of SARS-CoV-2-reactive clones, and raw data preprocessing instructions can be accessed from: https://github.com/pogorely/Minervina_COVID.
Acknowledgments
The study was supported by RSF 20-15-00351. E.R and A.F. are supported by the DFG Excellence Cluster Precision Medicine in Chronic Inflammation (Exc2167) and the DFG grant n. 4096610003, M.B.K., T.M., and A.M.W. are supported by European Research Council COG 724208. I.Z.M. is supported by RFBR 19-54-12011 and 18-29-09132. D.M.C. is supported by the grant from Ministry of Science and Higher Education of the Russian Federation 075-15-2019-1789.
References
- (1) Vabret N, et al. (2020) Immunology of COVID-19: current state of the science. Immunity p S1074761320301837.
- (2) Schmidt ME, Varga SM (2018) The CD8 T Cell Response to Respiratory Virus Infections. Frontiers in Immunology 9:678.
- (3) Swain SL, McKinstry KK, Strutt TM (2012) Expanding roles for CD4+ T cells in immunity to viruses. Nature Reviews Immunology 12:136–148.
- (4) Ng OW, et al. (2016) Memory T cell responses targeting the SARS coronavirus persist up to 11 years post-infection. Vaccine 34:2008–2014.
- (5) Oh HLJ, et al. (2011) Engineering T Cells Specific for a Dominant Severe Acute Respiratory Syndrome Coronavirus CD8 T Cell Epitope. Journal of Virology 85:10464–10471.
- (6) Zhao J, Zhao J, Perlman S (2010) T Cell Responses Are Required for Protection from Clinical Disease and for Virus Clearance in Severe Acute Respiratory Syndrome Coronavirus-Infected Mice. Journal of Virology 84:9318–9325.
- (7) Quinti I, et al. (2020) A possible role for B cells in COVID-19? Lesson from patients with agammaglobulinemia. Journal of Allergy and Clinical Immunology p S0091674920305571.
- (8) Soresina A, et al. (2020) Two X‐linked agammaglobulinemia patients develop pneumonia as COVID‐19 manifestation but recover. Pediatric Allergy and Immunology p pai.13263.
- (9) Thevarajan I, et al. (2020) Breadth of concomitant immune responses prior to patient recovery: a case report of non-severe COVID-19. Nature Medicine 26:453–455.
- (10) Bi Q, et al. (2020) Epidemiology and transmission of COVID-19 in 391 cases and 1286 of their close contacts in Shenzhen, China: a retrospective cohort study. The Lancet Infectious Diseases p S1473309920302875.
- (11) Miller JD, et al. (2008) Human effector and memory CD8+ T cell responses to smallpox and yellow fever vaccines. Immunity 28:710–722.
- (12) Ni L, et al. (2020) Detection of SARS-CoV-2-Specific Humoral and Cellular Immunity in COVID-19 Convalescent Individuals. Immunity p S1074761320301813.
- (13) Weiskopf D, et al. (2020) Phenotype of SARS-CoV-2-specific T-cells in COVID-19 patients with acute respiratory distress syndrome. medRxiv.
- (14) Braun J, et al. (2020) Presence of SARS-CoV-2 reactive T cells in COVID-19 patients and healthy donors. medRxiv.
- (15) Snyder TM, et al. (2020) Magnitude and Dynamics of the T-Cell Response to SARS-CoV-2 Infection at Both Individual and Population Levels., (Infectious Diseases (except HIV/AIDS)), preprint.
- (16) Le Bert N, et al. (2020) SARS-CoV-2-specific T cell immunity in cases of COVID-19 and SARS, and uninfected controls. Nature 584:457–462.
- (17) Meckiff BJ, et al. (2020) Single-cell transcriptomic analysis of SARS-CoV-2 reactive CD4 T cells., (Immunology), preprint.
- (18) Bacher P, et al. (2020) Pre-existing T cell memory as a risk factor for severe 1 COVID-19 in the elderly., (Allergy and Immunology), preprint.
- (19) Peng Y, et al. (2020) Broad and strong memory CD4 and CD8 T cells induced by SARS-CoV-2 in UK convalescent COVID-19 patients., (Immunology), preprint.
- (20) Mateus J, et al. (2020) Selective and cross-reactive SARS-CoV-2 T cell epitopes in unexposed humans. Science p eabd3871.
- (21) Grifoni A, et al. (2020) Targets of T cell responses to SARS-CoV-2 coronavirus in humans with COVID-19 disease and unexposed individuals. Cell.
- (22) Sekine T, et al. (2020) Robust T cell immunity in convalescent individuals with asymptomatic or mild COVID-19. Cell p S0092867420310084.
- (23) Minervina AA, et al. (2020) Primary and secondary anti-viral response captured by the dynamics and phenotype of individual T cell clones. eLife 9:e53704.
- (24) Pogorelyy MV, et al. (2018) Precise tracking of vaccine-responding T cell clones reveals convergent and personalized response in identical twins. Proceedings of the National Academy of Sciences of the United States of America 115:12704–12709.
- (25) DeWitt WS, et al. (2015) Dynamics of the cytotoxic T cell response to a model of acute viral infection. Journal of Virology 89:4517–4526.
- (26) Pogorelyy MV, et al. (2017) Persisting fetal clonotypes influence the structure and overlap of adult human T cell receptor repertoires. PLoS computational biology 13:e1005572.
- (27) Robinson MD, McCarthy DJ, Smyth GK (2010) edgeR: a Bioconductor package for differential expression analysis of digital gene expression data. Bioinformatics (Oxford, England) 26:139–140.
- (28) Puelma Touzel M, Walczak AM, Mora T (2020) Inferring the immune response from repertoire sequencing. PLOS Computational Biology 16:e1007873.
- (29) Fuertes Marraco SA, et al. (2015) Long-lasting stem cell-like memory CD8+ T cells with a naïve-like profile upon yellow fever vaccination. Science Translational Medicine 7:282ra48.
- (30) Bagaev DV, et al. (2020) VDJdb in 2019: database extension, new analysis infrastructure and a T-cell receptor motif compendium. Nucleic Acids Research 48:D1057–D1062.
- (31) Shomuradova AS, et al. (2020) Sars-cov-2 epitopes are recognized by a public and diverse repertoire of human t-cell receptors. medRxiv.
- (32) Dash P, et al. (2017) Quantifiable predictive features define epitope-specific T cell receptor repertoires. Nature 547:89–93.
- (33) Glanville J, et al. (2017) Identifying specificity groups in the T cell receptor repertoire. Nature 547:94–98.
- (34) Pogorelyy MV, et al. (2019) Detecting T cell receptors involved in immune responses from single repertoire snapshots. PLOS Biology 17:e3000314.
- (35) Emerson RO, et al. (2017) Immunosequencing identifies signatures of cytomegalovirus exposure history and HLA-mediated effects on the T cell repertoire. Nature Genetics 49:659–665.
- (36) Klinger M, et al. (2015) Multiplex Identification of Antigen-Specific T Cell Receptors Using a Combination of Immune Assays and Immune Receptor Sequencing. PLOS ONE 10:e0141561.
- (37) Stamatakis G, Samiotaki M, Mpakali A, Panayotou G, Stratikos E (2020) Generation of SARS-CoV-2 S1 spike glycoprotein putative antigenic epitopes in vitro by intracellular aminopeptidases., (Biochemistry), preprint.
- (38) DeWitt, William S I, et al. (2018) Human t cell receptor occurrence patterns encode immune history, genetic background, and receptor specificity. eLife 7:e38358.
- (39) Shugay M, et al. (2014) Towards error-free profiling of immune repertoires. Nature Methods 11:653–655.
- (40) Bolotin DA, et al. (2015) MiXCR: software for comprehensive adaptive immunity profiling. Nature Methods 12:380–381.










